PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009139421.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family S1Fa-like
Protein Properties Length: 127aa    MW: 14272.4 Da    PI: 11.7308
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009139421.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA128.42.1e-4060127370
            S1FA   3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 
                     +a++ea+GlnPGlivllv+gg+l++flv+n +lyv+aqknlPP+kkkP+skkklkreklkqGv+vPGe
  XP_009139421.1  60 KAAAEARGLNPGLIVLLVIGGPLVLFLVANIVLYVHAQKNLPPKKKKPISKKKLKREKLKQGVSVPGE 127
                     7899***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.1E-3563127IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MIRKKRVITL SACVCVLISS VRKRIFVFIR SSFFLPSPPF LRCSQRFRIV FMDGEDFARK  60
AAAEARGLNP GLIVLLVIGG PLVLFLVANI VLYVHAQKNL PPKKKKPISK KKLKREKLKQ  120
GVSVPGE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.140013e-80flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139421.15e-85PREDICTED: DNA-binding protein S1FA1-like
SwissprotP425513e-19S1FA1_ARATH; DNA-binding protein S1FA1
TrEMBLM4FFA78e-48M4FFA7_BRARP; Uncharacterized protein
STRINGBra039779.1-P2e-47(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769